PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g003150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 728aa    MW: 80254.3 Da    PI: 4.6822
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g003150.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.23e-861824181251
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAea+++++l+la+al++r+ +la++++ +m ++a+yf++ALa+r++r           +++  +++s e   +  f+e +P+lkf+h
  Csa01g003150.1 182 LVHALVACAEAIQQDNLTLADALVKRVGTLAASQAGAMGKVATYFAQALARRIYR---------GYTAD--TDVSFEEVLQMHFYESCPYLKFAH 265
                     689****************************************************.........22223..235666556667************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIleav++++rvH+iD++++qG+QWpaL+qaLa Rp+gpp +R+Tgvg+p+++++++l+++g+rLa+fA++lgv+fef+ l+a++l+dle
  Csa01g003150.1 266 FTANQAILEAVATSRRVHVIDLGLNQGMQWPALMQALALRPGGPPLFRLTGVGPPQKENSDSLQQLGWRLAQFAQNLGVEFEFKGLAAESLSDLE 360
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                     +e+++++p  E+l+Vn+v++lhrll++s+s+e+    +L +vk ++P +v+vveqea+hn  
  Csa01g003150.1 361 PEMFETRPeSETLVVNSVFELHRLLARSGSIEK----LLGTVKAVKPSIVTVVEQEANHNXD 418
                     ********9************************....**********************975 PP

2GRAS391.21.2e-11942671879374
            GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelg 173
                       +  f+e +P+lkf+h+taNqaIleav++++rvH+iD++++qG+QWpaL+qaLa Rp+gpp +R+Tgvg+p+++++++l+++g+rLa+fA++lg
  Csa01g003150.1 426 VLQMHFYESCPYLKFAHFTANQAILEAVATSRRVHVIDLGLNQGMQWPALMQALALRPGGPPLFRLTGVGPPQKENSDSLQQLGWRLAQFAQNLG 520
                     33445****************************************************************************************** PP

            GRAS 174 vpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                     v+fef+ l+a++l+dle+e+++++p  E+l+Vn+v++lhrll++s+s+e+    +L +vk ++P +v+vveqea+hn+  Fl+rf eal+yys+l
  Csa01g003150.1 521 VEFEFKGLAAESLSDLEPEMFETRPeSETLVVNSVFELHRLLARSGSIEK----LLGTVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSL 611
                     *************************9************************....***************************************** PP

            GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                     fdsle +++  s++r+ +++++lg +i nvva+eg++r+erhetl +Wr+r+++ GF pv+l+++  kqa+ ll+ ++ +dgyrvee++g+l+lg
  Csa01g003150.1 612 FDSLEDSYSLPSQDRA-MSEVYLGGQILNVVAAEGTDRVERHETLPQWRNRMKTGGFDPVHLGSSGFKQASILLSVFAaGDGYRVEEKDGCLMLG 705
                     *******988887776.56677************************************************************************* PP

            GRAS 362 WkdrpLvsvSaWr 374
                     W++rpL+++SaW+
  Csa01g003150.1 706 WQTRPLITTSAWK 718
                     ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011295.7E-4042114No hitNo description
PfamPF120414.1E-3442108IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098561.953156697IPR005202Transcription factor GRAS
PfamPF035141.0E-83182418IPR005202Transcription factor GRAS
PfamPF035144.0E-117426718IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MKRGHGETWD PPRPSRCSGE GPAMVDKKMA AADDNNNNNM DDELLAVLGY KVRSSEMAEV  60
AQKLEQLEMV LSNDDVGSST LLNDTVHYNP SDLSNWVESM LSELNNPASS DLDPTTGGCV  120
DRSEYDLRAI PGLSAFPKQE EEVFDEEEAS SKRIRLGSYC ESTGESTRPV VLVDSQETWV  180
RLVHALVACA EAIQQDNLTL ADALVKRVGT LAASQAGAMG KVATYFAQAL ARRIYRGYTA  240
DTDVSFEEVL QMHFYESCPY LKFAHFTANQ AILEAVATSR RVHVIDLGLN QGMQWPALMQ  300
ALALRPGGPP LFRLTGVGPP QKENSDSLQQ LGWRLAQFAQ NLGVEFEFKG LAAESLSDLE  360
PEMFETRPES ETLVVNSVFE LHRLLARSGS IEKLLGTVKA VKPSIVTVVE QEANHNXDTD  420
VSFEEVLQMH FYESCPYLKF AHFTANQAIL EAVATSRRVH VIDLGLNQGM QWPALMQALA  480
LRPGGPPLFR LTGVGPPQKE NSDSLQQLGW RLAQFAQNLG VEFEFKGLAA ESLSDLEPEM  540
FETRPESETL VVNSVFELHR LLARSGSIEK LLGTVKAVKP SIVTVVEQEA NHNGVVFLDR  600
FNEALHYYSS LFDSLEDSYS LPSQDRAMSE VYLGGQILNV VAAEGTDRVE RHETLPQWRN  660
RMKTGGFDPV HLGSSGFKQA SILLSVFAAG DGYRVEEKDG CLMLGWQTRP LITTSAWKLA  720
GAAESRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-541827184375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ1777590.0GQ177759.1 Arabidopsis thaliana ecotype Cvi-0 RGL2 gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010510882.10.0PREDICTED: DELLA protein RGL2 isoform X2
RefseqXP_010510814.10.0PREDICTED: DELLA protein RGL2 isoform X1
SwissprotQ8GXW10.0RGL2_ARATH; DELLA protein RGL2
TrEMBLD7L0H60.0D7L0H6_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.3__292__AT3G03450.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2